PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3B_9769B2425.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 82aa    MW: 9479.9 Da    PI: 9.1978
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3B_9769B2425.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR142.12.8e-1319654390
                  FAR1 43 eekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90
                          ++ kk++k+r++ +  +tgCkak+ vk   dg+wev+ +++eHnH+l 
  Traes_3B_9769B2425.1 19 SKGKKSSKKRKRDKIVQTGCKAKMIVKII-DGRWEVIYFVSEHNHPLI 65
                          3344468999999****************.****************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031013.4E-111965IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 82 aa     Download sequence    Send to blast
EQAKDDNEDE AIVFLDDDSK GKKSSKKRKR DKIVQTGCKA KMIVKIIDGR WEVIYFVSEH  60
NHPLIDKPCL TKYLRSHQGI PP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703061e-135HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229498.12e-23PREDICTED: uncharacterized protein LOC100826282
TrEMBLW5HPJ11e-52W5HPJ1_WHEAT; Uncharacterized protein
TrEMBLW5HPJ21e-52W5HPJ2_WHEAT; Uncharacterized protein
STRINGMLOC_74313.12e-30(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP9528843
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76320.23e-07FAR1-related sequence 4
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]